DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG10140

DIOPT Version :10

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:104/279 - (37%) Gaps:89/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1295 STLKSPTGTTPGHQ-----EDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIK 1354
            |||::.: ||.|.:     .:.:.|.|:.:.:||.....||:||:|.:|:||...|.....|:..
  Fly    32 STLETDS-TTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRSGQAIELQCEWPYEFNAN 95

  Fly  1355 RKVCNFPSLVDC-PLDEA-------------------------------------------PENV 1375
            .:.|..|...|| |..||                                           |:||
  Fly    96 TQSCVHPGDADCLPTCEAFNFSTFSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNV 160

  Fly  1376 TKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQ--CPQGLHFDIKSNFCNYPILV 1438
            ....|:.....:...||   ||....||.::::|.||  |||:  |..||||..|.:.|:.|...
  Fly   161 DCVESECSIYSNAYHLR---YVPSKVSCQKYFICGNG--IPREQTCTAGLHFSTKCDCCDIPSKS 220

  Fly  1439 QCSLEESQADAHGALLAEGVPDCTKVKEDTRFGDV-----------------KQHNKYYVCLKGK 1486
            .|.:...:               .||::.:|...|                 .:.:.||.|:.|.
  Fly   221 DCQIPAVE---------------RKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCVDGH 270

  Fly  1487 AVLHYCSPGNWFDLRSQKC 1505
            .::..||.|.|:|...|:|
  Fly   271 GLVLDCSAGLWYDPTVQEC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
dermokine <1084..>1257 CDD:455732
CBM_14 1314..1366 CDD:426342 16/51 (31%)
CBM_14 1388..1440 CDD:426342 20/53 (38%)
ChtBD2 1459..1505 CDD:214696 14/62 (23%)
CG10140NP_648648.2 CBM_14 63..106 CDD:426342 14/42 (33%)
CBM_14 111..161 CDD:426342 4/49 (8%)
CBM_14 178..222 CDD:426342 18/45 (40%)
ChtBD2 244..292 CDD:214696 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.