DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG10140

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:279 Identity:67/279 - (24%)
Similarity:104/279 - (37%) Gaps:89/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1295 STLKSPTGTTPGHQ-----EDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIK 1354
            |||::.: ||.|.:     .:.:.|.|:.:.:||.....||:||:|.:|:||...|.....|:..
  Fly    32 STLETDS-TTSGLEYGLITGNLSICGNVADNVFLPFVGDCNRYYLCRSGQAIELQCEWPYEFNAN 95

  Fly  1355 RKVCNFPSLVDC-PLDEA-------------------------------------------PENV 1375
            .:.|..|...|| |..||                                           |:||
  Fly    96 TQSCVHPGDADCLPTCEAFNFSTFSYQRTCTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNV 160

  Fly  1376 TKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQ--CPQGLHFDIKSNFCNYPILV 1438
            ....|:.....:...||   ||....||.::::|.||  |||:  |..||||..|.:.|:.|...
  Fly   161 DCVESECSIYSNAYHLR---YVPSKVSCQKYFICGNG--IPREQTCTAGLHFSTKCDCCDIPSKS 220

  Fly  1439 QCSLEESQADAHGALLAEGVPDCTKVKEDTRFGDV-----------------KQHNKYYVCLKGK 1486
            .|.:...:               .||::.:|...|                 .:.:.||.|:.|.
  Fly   221 DCQIPAVE---------------RKVQQLSRLSPVTTVGICPPSGVHFYVHESRRDAYYYCVDGH 270

  Fly  1487 AVLHYCSPGNWFDLRSQKC 1505
            .::..||.|.|:|...|:|
  Fly   271 GLVLDCSAGLWYDPTVQEC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 16/51 (31%)
CBM_14 1388..1440 CDD:279884 20/53 (38%)
ChtBD2 1459..1505 CDD:214696 14/62 (23%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 14/42 (33%)
CBM_14 111..161 CDD:279884 4/49 (8%)
CBM_14 178..222 CDD:279884 18/45 (40%)
CBM_14 246..295 CDD:279884 11/44 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.