DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG10725

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:109/272 - (40%) Gaps:83/272 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1302 GTTPGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDC 1366
            |:......|...|||:.|.:|:....:|:||::|:|..|:...||.:.:||.:.:.|       .
  Fly    15 GSCSAADGDVNVCSNVVNNLFVPQVGNCSKYFLCMNEIAVPRECPTDYYFDARDQEC-------V 72

  Fly  1367 PLDEAPENVTKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQGLHFDIKSNF 1431
            ||.|           .|....||:....::..| ::|:::.:|.:|..:.|||..||.::..::.
  Fly    73 PLME-----------VECIGSCKNRGLSSFCYD-RTCTKYVLCFDGTPVIRQCSDGLQYNALTDR 125

  Fly  1432 CNYPILVQC--SL--------------EESQADAHGALLAEGVP---DCTK-------------- 1463
            |:||..|.|  :|              .:::.|.: .:..:|:|   :||.              
  Fly   126 CDYPQYVDCVDNLCSRNNNPDDIVFIPSKARCDKY-YICMDGLPQVQNCTSGLQYNPSTQSCDFP 189

  Fly  1464 -----------------VKEDTRFGDV-------------KQHNKYYVCLKGKAVLHYCSPGNWF 1498
                             .:...|..|:             |:.:.||.||.|:.|...|:||..|
  Fly   190 SKVNCTVESLQRNILPFARAPPRLADIECPSEGAHFIAHQKRQDAYYYCLNGRGVTLDCTPGLVF 254

  Fly  1499 DLRSQKCIDQRL 1510
            |.:.::|.:..|
  Fly   255 DAKREECREPHL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 16/51 (31%)
CBM_14 1388..1440 CDD:279884 15/51 (29%)
ChtBD2 1459..1505 CDD:214696 17/92 (18%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 12/44 (27%)
CBM_14 83..134 CDD:279884 15/51 (29%)
CBM_14 150..192 CDD:279884 5/42 (12%)
ChtBD2 216..264 CDD:214696 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D33909at6656
OrthoFinder 1 1.000 - - FOG0012676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.