Sequence 1: | NP_648504.2 | Gene: | Muc68D / 39326 | FlyBaseID: | FBgn0036203 | Length: | 1514 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648647.1 | Gene: | CG10725 / 39510 | FlyBaseID: | FBgn0036362 | Length: | 269 | Species: | Drosophila melanogaster |
Alignment Length: | 272 | Identity: | 60/272 - (22%) |
---|---|---|---|
Similarity: | 109/272 - (40%) | Gaps: | 83/272 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 1302 GTTPGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDC 1366
Fly 1367 PLDEAPENVTKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQGLHFDIKSNF 1431
Fly 1432 CNYPILVQC--SL--------------EESQADAHGALLAEGVP---DCTK-------------- 1463
Fly 1464 -----------------VKEDTRFGDV-------------KQHNKYYVCLKGKAVLHYCSPGNWF 1498
Fly 1499 DLRSQKCIDQRL 1510 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Muc68D | NP_648504.2 | ChtBD2 | 21..69 | CDD:214696 | |
PHA03249 | 1088..>1209 | CDD:223023 | |||
CBM_14 | 1314..1366 | CDD:279884 | 16/51 (31%) | ||
CBM_14 | 1388..1440 | CDD:279884 | 15/51 (29%) | ||
ChtBD2 | 1459..1505 | CDD:214696 | 17/92 (18%) | ||
CG10725 | NP_648647.1 | CBM_14 | 35..73 | CDD:279884 | 12/44 (27%) |
CBM_14 | 83..134 | CDD:279884 | 15/51 (29%) | ||
CBM_14 | 150..192 | CDD:279884 | 5/42 (12%) | ||
ChtBD2 | 216..264 | CDD:214696 | 13/47 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D33909at6656 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0012676 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.020 |