DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG7213

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_648195.1 Gene:CG7213 / 38924 FlyBaseID:FBgn0035861 Length:449 Species:Drosophila melanogaster


Alignment Length:133 Identity:27/133 - (20%)
Similarity:45/133 - (33%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MNNATQSIKKSNDHKKEVTIKQNISVDRPLIFNIFGNFNFFASLWGNSHETTP------SPLK-P 128
            ||.....:...:.....:||:|.:.:|..:..:..|..:..||.....:...|      .|:: |
  Fly    19 MNKEEHQLFVHDSRMISLTIQQQLIMDGAVFKDHLGQLHRTASFVNKMYLDMPLNFEIFLPIRLP 83

  Fly   129 NPIA------------------HFQFINSAVGIEPLS---QDNLADKDKKDIISSSSDSSPTEDA 172
            ..:.                  |..|..:||.::.|:   |..|.....|...:||..|..|.|.
  Fly    84 EAVVPTYDENKRSVELTRANCQHPFFFGNAVNVKCLNLLLQSELQRAISKVKTASSVCSGRTYDI 148

  Fly   173 TYS 175
            .||
  Fly   149 KYS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884
CBM_14 1388..1440 CDD:279884
ChtBD2 1459..1505 CDD:214696
CG7213NP_648195.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYTF
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.