DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG13806

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:214 Identity:40/214 - (18%)
Similarity:68/214 - (31%) Gaps:82/214 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1303 TTPGHQ---EDRTDCSNMPNGIFLRDFQSCNKYYVCL--------------NGKAI--------- 1341
            |.|.|.   |....|::  .||| .|...|.||::|.              |.||.         
  Fly    90 TGPCHPFGIEGNFQCTS--QGIF-PDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDATTGQCTL 151

  Fly  1342 ----------------AGH-------------CPRNLHFDIKRKVCNFPSLVDC----------- 1366
                            |||             |...::.::...:..:|||..|           
  Fly   152 TLTDSVCLQRQYYCPNAGHVAAWPTNPNIFYVCKSTVNQNLNDTIVIYPSLHRCNDGETFVDYVC 216

  Fly  1367 --------PLDEAPENVTKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCA--NGRAIPRQCPQ 1421
                    |..:.|..:.:.|:|.:.:....:.::...:.|...|.::|.|:  ||......||.
  Fly   217 RSGSNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVGLMADGNDCRKYYYCSALNGTLRHMDCPN 281

  Fly  1422 GLHFDIKSNFCNYPILVQC 1440
            |.::..:.:.|   :|..|
  Fly   282 GTYYRPELSSC---VLGSC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 19/103 (18%)
CBM_14 1388..1440 CDD:279884 11/53 (21%)
ChtBD2 1459..1505 CDD:214696
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 11/55 (20%)
ChtBD2 247..293 CDD:214696 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.