DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and obst-B

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:305 Identity:78/305 - (25%)
Similarity:114/305 - (37%) Gaps:74/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1219 GITSTTGAPYTTDNPASQEPSPSAPENPGDSGNSSSE---SPPEGATPCTPNAPKKSTTSSYTAH 1280
            |:|:|                 .|.|:.|....|:|:   .|  |..|...:.|.::......|.
  Fly    21 GLTAT-----------------KAQESRGGFRGSNSQFRVGP--GHPPSQRHLPPRNRDPVQEAS 66

  Fly  1281 PTPKYTTEGNKAETSTLK--SPTGTTPGHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAG 1343
            ..||      ..:|:..|  .||...|           .||| |..|.:.|:|||.||:|.....
  Fly    67 VVPK------SKQTAAEKEYEPTEECP-----------EPNG-FYPDSKQCDKYYACLDGVPTER 113

  Fly  1344 HCPRNLHFD----IKRKVCNFPSLVDCPLDEAPENVTKKPSDTESTPDCKSLRNGAYVRD-PKSC 1403
            .|...:.|:    |:.| |:.|..:||    ...:..:.|..:...|    .:||.:..: |..|
  Fly   114 LCADGMVFNDYSPIEEK-CDLPYNIDC----MKRSKLQTPQPSLHCP----RKNGYFGHEKPGIC 169

  Fly  1404 SRFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPD--CTKVKE 1466
            .:||.|.:|:.....||.||.|:.|:..|.:|         .|....|. .:|.|.|  |.||.|
  Fly   170 DKFYFCVDGQFNMITCPAGLVFNPKTGICGWP---------DQVGVTGC-KSEDVFDFECPKVNE 224

  Fly  1467 D-----TRFGDVKQHNKYYVCLKGKAV-LHYCSPGNWFDLRSQKC 1505
            .     .|:.|......:|||:.|... .:.|..|..||...:.|
  Fly   225 SIAVTHPRYADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKETC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 18/55 (33%)
CBM_14 1388..1440 CDD:279884 16/52 (31%)
ChtBD2 1459..1505 CDD:214696 15/53 (28%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 18/51 (35%)
CBM_14 156..204 CDD:279884 16/56 (29%)
CBM_14 233..278 CDD:279884 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.