Sequence 1: | NP_648504.2 | Gene: | Muc68D / 39326 | FlyBaseID: | FBgn0036203 | Length: | 1514 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523418.1 | Gene: | Peritrophin-A / 33023 | FlyBaseID: | FBgn0022770 | Length: | 230 | Species: | Drosophila melanogaster |
Alignment Length: | 203 | Identity: | 56/203 - (27%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 40/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1327 QSCNKYYVCLNGKAIAGHCPRNLHFDIKRKV---CNFPSLVDC---PLDEAPENVTKKPSDTEST 1385
Fly 1386 PDCKSLRNGAYVRDPKSCSRFYV-CANGRAIPRQCPQGLHFDIKSNFCNYP--ILVQCSLEESQA 1447
Fly 1448 DAHGALLAEGVPDCTKVKEDT---------RFGDVKQHNKYYVCLKGKAVLHYCSPGNWFDLRSQ 1503
Fly 1504 KCIDQRLA 1511 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Muc68D | NP_648504.2 | ChtBD2 | 21..69 | CDD:214696 | |
PHA03249 | 1088..>1209 | CDD:223023 | |||
CBM_14 | 1314..1366 | CDD:279884 | 13/41 (32%) | ||
CBM_14 | 1388..1440 | CDD:279884 | 18/54 (33%) | ||
ChtBD2 | 1459..1505 | CDD:214696 | 12/54 (22%) | ||
Peritrophin-A | NP_523418.1 | CBM_14 | 36..83 | CDD:279884 | 13/41 (32%) |
CBM_14 | 103..147 | CDD:279884 | 16/44 (36%) | ||
ChtBD2 | 179..218 | CDD:214696 | 9/38 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |