DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and obst-I

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_728731.1 Gene:obst-I / 317966 FlyBaseID:FBgn0052304 Length:219 Species:Drosophila melanogaster


Alignment Length:234 Identity:57/234 - (24%)
Similarity:81/234 - (34%) Gaps:66/234 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1281 PTPKYTTEGNKAETSTLKSPTGTTPGHQEDRTDCSNMPNGIFLRDFQSC------NKYYVCLNGK 1339
            |...|..|..:|..||             |.|.|:|...|       .|      :::.||.:..
  Fly    40 PDDYYFNETIQACVST-------------DTTSCTNHQIG-------KCPMATEMDEFCVCKDKH 84

  Fly  1340 AIAGHCPRNLHFDIKRKVCNFPSLVDCPLDEAPENVTKKPSDTESTPDCKSLRNGAYVRDPKSCS 1404
            .....||...:||..|.||...| |:|..|..|   :..|:.|.|...|                
  Fly    85 LQIWKCPEGTYFDANRLVCRVGS-VECQDDYTP---SPCPNSTASDVFC---------------- 129

  Fly  1405 RFYVCANGRAIPRQCPQGLHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPDCTKVKEDTR 1469
               :|.:|:.....||.|..||.:...|    |...|.::....:.|.....|:           
  Fly   130 ---LCIDGKWHLNYCPTGFTFDDELQIC----LNTGSDDDELPSSSGKCQRLGL----------- 176

  Fly  1470 FGDVKQHNKYYVCL-KGKAVLHY-CSPGNWFDLRSQKCI 1506
            |||....:.||.|. ||..:.:: ||.|..|:|.|..|:
  Fly   177 FGDPADCSGYYHCREKGSDIEYFRCSVGTIFNLISFACV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 15/57 (26%)
CBM_14 1388..1440 CDD:279884 10/51 (20%)
ChtBD2 1459..1505 CDD:214696 14/47 (30%)
obst-INP_728731.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.