DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and CG43218

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:NP_001246864.1 Gene:CG43218 / 12798438 FlyBaseID:FBgn0262854 Length:182 Species:Drosophila melanogaster


Alignment Length:144 Identity:40/144 - (27%)
Similarity:52/144 - (36%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1314 CSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDCP----------- 1367
            ||.......:.|.:.|:.||:|.:|......||:.|.|||....|   .|..||           
  Fly    34 CSGHLVNDLVPDCEDCSGYYICGDGSYEKVKCPQGLIFDIALNTC---VLGQCPRFDGTCSANST 95

  Fly  1368 ---------LDEAPENVTKKPS---DTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCP 1420
                     ...|||.:...||   |.:.|  |:.....  :..|..|..||.|....|:...|.
  Fly    96 VPPPVTTTTTTAAPETIPPTPSGPCDNDVT--CQLQEKS--IPHPTHCRNFYTCYGKCAVLGLCE 156

  Fly  1421 QGLHFDIKSNFCNY 1434
            .|..||.:.|.|||
  Fly   157 LGKWFDREGNVCNY 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 16/51 (31%)
CBM_14 1388..1440 CDD:279884 15/47 (32%)
ChtBD2 1459..1505 CDD:214696
CG43218NP_001246864.1 CBM_14 34..79 CDD:279884 15/47 (32%)
CBM_14 133..177 CDD:279884 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.