DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc68D and LOC110437948

DIOPT Version :9

Sequence 1:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:224 Identity:52/224 - (23%)
Similarity:69/224 - (30%) Gaps:90/224 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1264 CTPNAPKKSTTSSYTAHPTPKYTTEGNKAETSTLKSPTGTT---PGHQEDRTDCSNMPNGIFLRD 1325
            ||..|...:.....|.|..|    ||:..       |.|.|   |.|           :|.|:..
Zfish    16 CTEKAESPTPIDGITGHVCP----EGHYC-------PPGATRPVPCH-----------SGTFVTV 58

  Fly  1326 FQ-----SCNKYYVCLNGKAI---AG-HCPRNLHFDIKRKVCNFPSLVDCPLDEAPENVTKKP-S 1380
            .|     :|...:.|.:|..:   || :||....:||:          .||..      |..| |
Zfish    59 PQASQCWACTAGWYCADGGRLLCPAGFYCPEGTGYDIR----------PCPAG------TYSPDS 107

  Fly  1381 DTESTPDCKSLRNGAYVRDPKS------CSRFYVCANGR-------------------------- 1413
            ...|..:|::...|.|.....|      ||..|.||.|.                          
Zfish   108 GLISLSECRACDGGHYCSLQNSSSVTGQCSEGYYCAQGNISPQPYTQNTGVGGLCPVGHFCPQGT 172

  Fly  1414 AIPRQCPQGLHFDIKSNFCNYPILVQCSL 1442
            |.|:.||:|       .|.|...||:.||
Zfish   173 AQPQPCPEG-------TFSNRTKLVKVSL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 12/60 (20%)
CBM_14 1388..1440 CDD:279884 19/83 (23%)
ChtBD2 1459..1505 CDD:214696
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.