Sequence 1: | NP_648504.2 | Gene: | Muc68D / 39326 | FlyBaseID: | FBgn0036203 | Length: | 1514 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021322084.1 | Gene: | LOC108179232 / 108179232 | -ID: | - | Length: | 185 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 46/204 - (22%) |
---|---|---|---|
Similarity: | 63/204 - (30%) | Gaps: | 63/204 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 1263 PCTP----NAPKKSTTSSYTAHPTPKYTTEGNKAETSTLKSPTGT-TPGHQEDRTDCSN-----M 1317
Fly 1318 P-NGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVDCPLDEAPENVTKKPSD 1381
Fly 1382 TESTPDCKSLRNGAYV---RDPKSCSRFYVCANGRA---IPRQCPQGLHFDIKSNFCNYPILVQC 1440
Fly 1441 SLEESQADA 1449 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Muc68D | NP_648504.2 | ChtBD2 | 21..69 | CDD:214696 | |
PHA03249 | 1088..>1209 | CDD:223023 | |||
CBM_14 | 1314..1366 | CDD:279884 | 13/57 (23%) | ||
CBM_14 | 1388..1440 | CDD:279884 | 11/57 (19%) | ||
ChtBD2 | 1459..1505 | CDD:214696 | |||
LOC108179232 | XP_021322084.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D487374at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |