DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr98a

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:104/271 - (38%) Gaps:72/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 IILLLIYFLQLLYSTLLALYLRTLMMNLA-QRIGFLNQKLDTFNLQDCGHMENWREL----SNLI 224
            ||..||:.:..:||.      |.|.:|.. ..:.|| .:...|.|.....:..::||    ||::
  Fly   137 IIRWLIFIVVTIYSN------RALTINATYSELVFL-ARFSEFTLYCAVILFIYQELIVGGSNVL 194

  Fly   225 EVLCKFRY----------------------ITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATL 267
            :.|.:.||                      :.:.|.|     |..||..|..|:..:.::..:.|
  Fly   195 DELYRTRYEMWSIRRLSLQKLAKLQAIHNSLWQAIRC-----LECYFQLSLITLLMKFFIDTSAL 254

  Fly   268 TAGSLSSKTE---------VADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIY-- 321
            ......|:.|         ||.   :.||.:| |.:....:|:.||.:      ..:.|:..|  
  Fly   255 PYWLYLSRVEHTRVAVQHYVAT---VECIKLL-EIVVPCYLCTRCDAM------QRKFLSMFYTV 309

  Fly   322 ---GKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF------KQ 377
               .:|.|....:.....:..::..:|:|.|...|:...|.|.|..:.:|:||.|||      |:
  Fly   310 TTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIVICIQFSINFRAKK 374

  Fly   378 LEDSKVEDISQ 388
            :.:   |.:||
  Fly   375 MSN---EQMSQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 57/260 (22%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 56/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.