DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr63a

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001137883.1 Gene:Gr63a / 38453 FlyBaseID:FBgn0035468 Length:489 Species:Drosophila melanogaster


Alignment Length:405 Identity:88/405 - (21%)
Similarity:147/405 - (36%) Gaps:80/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQDIYPISKPSQIFAILPFY-SGDVDDGFRFGGLGRWYGRL--VALIILIGSLTLGEDVLFASKE 65
            |::|.||:...:|..:||.. .|.....|........|..:  |.|...:|.:        |:..
  Fly    74 YRNIDPINWFLRIIGVLPIVRHGPARAKFEMNSASFIYSVVFFVLLACYVGYV--------ANNR 130

  Fly    66 YRLVASAQGDTEE--------INRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLA 122
            ..:|.|..|..||        :|.....::.|:.|....::.:.|....|..|:  .:|..:.|.
  Fly   131 IHIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLY--YQISGHSLP 193

  Fly   123 NGFRE--TYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYL 185
            ...|:  .|....|.||      .||:|...:: ..|.:...:.:...::..|..:......|..
  Fly   194 LKLRQKAVYIAIVLPIL------SVLSVVITHV-TMSDLNINQVVPYCILDNLTAMLGAWWFLIC 251

  Fly   186 RTLMMN---LAQRIGFLNQKLDTFNLQDCG-------HMENWRELSNLIEVLCKFRYITENINCV 240
            ..:.:.   ||:|.    ||.    |:..|       :...|..||.|..       .|.|..|.
  Fly   252 EAMSITAHLLAERF----QKA----LKHIGPAAMVADYRVLWLRLSKLTR-------DTGNALCY 301

  Fly   241 AGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTE---VADTIGL--SCIWVLAETITMIVIC 300
            ..|.:..|.   |:.:|...|        |.:|..:|   :.| |||  :.:|.:.   .:..||
  Fly   302 TFVFMSLYL---FFIITLSIY--------GLMSQLSEGFGIKD-IGLTITALWNIG---LLFYIC 351

  Fly   301 SACDGLASEVNGTAQ---ILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFK-I 361
            ......:..|....|   ::..:...:...|..|:.||..:..........|||.: |.|||| :
  Fly   352 DEAHYASVNVRTNFQKKLLMVELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDV-NRTLFKGL 415

  Fly   362 FSAVTTYLVILIQFK 376
            .:.:.||||:|:||:
  Fly   416 LTTMVTYLVVLLQFQ 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 87/402 (22%)
Gr63aNP_001137883.1 7tm_7 79..433 CDD:285581 86/400 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.