DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr59f

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:396 Identity:76/396 - (19%)
Similarity:141/396 - (35%) Gaps:103/396 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQN 102
            |:| |||.|..:|  |..|..||.:..|:.||.:.:...:.....||:.:.::....::|.    
  Fly    61 RFY-RLVHLSWMI--LWYGLFVLGSYWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLL---- 118

  Fly   103 ASRHFRTLHDIAKIDEYLLANGFRETYSCRN-----LTILVTSAAG------------------- 143
                                     |:.|||     :|.:|||...                   
  Fly   119 -------------------------TWQCRNWAPKLMTNIVTSDLNRAYTIDCNRTKRFIRLQLF 158

  Fly   144 --GVLA-VAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDT 205
              |:.| :|.::..:.......|.|:.:..|.:..:.|::.......|:..:|.|...|.:.|: 
  Fly   159 LVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLE- 222

  Fly   206 FNLQDCGHMENWRELSNL----IEVLCKFRY-------ITENINCVAGVSLLFYFGFSFYTVTNQ 259
                        |||::|    |..:.|.|.       .|:.:|.....|:|..|...|......
  Fly   223 ------------RELTHLHSPRISEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLV 275

  Fly   260 SYLAFATLTAGSLSSKTEVADTIGLSCIWV-LAETITMIV--ICSAC---DGLASEVNGTAQILA 318
            .:|.:..:...|::..|:          || :...:.|.|  :||..   ..:.:|.:....:|:
  Fly   276 LFLVYQGIENPSMADFTK----------WVCMLLWLAMHVGKVCSILHFNQSIQNEHSTCLTLLS 330

  Fly   319 RIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKV 383
            |:....|..|:.|..|:.:......|....|..::|...|..:..|...:.:.|:|:    |...
  Fly   331 RVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQY----DVTY 391

  Fly   384 EDISQA 389
            |.:|::
  Fly   392 EALSKS 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 73/384 (19%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 73/385 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.