DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr59e

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:410 Identity:84/410 - (20%)
Similarity:143/410 - (34%) Gaps:127/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GLGRWYGRLVALIILI----GSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISY--- 92
            |:.||...|.:|.:|:    ||:.       ...|:         |.|| .|||.||.::.:   
  Fly    26 GVLRWLHTLWSLFLLMYIWTGSIV-------KCLEF---------TVEI-PTIEKLLYLMEFPGN 73

  Fly    93 ----TMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFR--------ETYSCRNLTILVTSAAGGV 145
                .::|..:|.|     |.|...|::....:..|.:        :.:..|.|.::.|:.....
  Fly    74 MATIAILVYYAVLN-----RPLAHGAELQIERIITGLKGKAKRLVYKRHGQRTLHLMATTLVFHG 133

  Fly   146 LAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNL-----AQRIGFL------ 199
            |.|....::|.              :.....:|:.....|..|||:|     ||.:.||      
  Fly   134 LCVLVDVVNYD--------------FEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLWLVMDQ 184

  Fly   200 -----------------NQKLDTFN------LQDCG-----HMENWRELSNLIE-----VLCKF- 230
                             :.|||...      |.|.|     .:|..|...||||     .|.:| 
  Fly   185 MRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFG 249

  Fly   231 RYITEN-INCVAGVSLLFYFGFSFY--TVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAE 292
            .|:..| :|.:..:.:..|..|:|:  .:..:|.|....|                   :|:...
  Fly   250 LYLVLNLLNSLVSICVELYLIFNFFETPLWEESVLLVYRL-------------------LWLAMH 295

  Fly   293 TITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNLIDKF---LTKSIKQDLQFTAYGFFSID 354
            ...:..|.|..:.:..:.....|:|..:...|.:.|..|::|   |.:||.|.|:  |.|..::|
  Fly   296 GGRIWFILSVNEQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQRSIDQPLE--ACGIVTLD 358

  Fly   355 NSTLFKIFSAVTTYLVILIQ 374
            ..:|......:...::.|||
  Fly   359 TRSLGGFIGVLMAIVIFLIQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 84/410 (20%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 84/410 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.