DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr21a

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:311 Identity:62/311 - (19%)
Similarity:106/311 - (34%) Gaps:89/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAFY 151
            ||:.|:   :||...|.|             :|.|...||..|:                 .|:|
  Fly   207 LCVFSW---LLSIAINLS-------------QYFLQPDFRLWYT-----------------FAYY 238

  Fly   152 YIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMEN 216
                        .||.:|..|..|.|....|....:..::.|.:.....:| ....|.:..|:  
  Fly   239 ------------PIIAMLNCFCSLWYINCNAFGTASRALSDALQTTIRGEK-PAQKLTEYRHL-- 288

  Fly   217 WRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADT 281
            |.:||::::.|.:.......:.|:.          .|:|....:|        ||:|...:...|
  Fly   289 WVDLSHMMQQLGRAYSNMYGMYCLV----------IFFTTIIATY--------GSISEIIDHGAT 335

  Fly   282 IGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNL------IDKFLTKSIK 340
            .         :.:.:.||...|.||...:...|...:|..|...|.:.|      :|....|.::
  Fly   336 Y---------KEVGLFVIVFYCMGLLYIICNEAHYASRKVGLDFQTKLLNINLTAVDAATQKEVE 391

  Fly   341 QDLQ--------FTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKV 383
            ..|.        ....|:.:|:...:....|.:.||||:|:|||..|..::
  Fly   392 MLLVAINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKITEQRRI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 61/305 (20%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 61/305 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.