DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr9a

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:386 Identity:76/386 - (19%)
Similarity:140/386 - (36%) Gaps:101/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GFRFGGLGRWYGRLVA--LIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISY 92
            |...|..|...|||::  .::||....:||...:.::|       ..|.|.:.          :|
  Fly    17 GLVCGWSGSRLGRLLSSTFLVLILIELVGEIETYFTEE-------NPDNESVP----------AY 64

  Fly    93 TMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRS 157
            ...|:..|..|   ::.:|....:.         ..:.||....|:.... .|.|.:|.|.|.  
  Fly    65 FAKVIMGVNMA---YKMIHAWIALS---------ALFECRRFRYLLEELP-PVKATSFIYRHL-- 114

  Fly   158 GIGAKRQIILLLIY----FLQLLYSTLLALYLRTL---------------MMNLAQRIGFLNQKL 203
                   |:.::::    ||.|...|:..:||..|               ||.|..|   |:.||
  Fly   115 -------ILEIILFACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARYLQMMVLVDR---LDGKL 169

  Fly   204 DTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLF---------------YFGFSF 253
            :..:.:......:::.|......|.|   :|.:::.:.|:|||.               ||..::
  Fly   170 EQLHHRVISGSSDYKTLRLDYAHLAK---VTRSLSHLFGLSLLLLNVLCLGDWIIVCNVYFMVAY 231

  Fly   254 YTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMI-VICSACDGLASEVNGTAQIL 317
            ..|...:...|..:                   ::|:..|:..| .||:|.....|:.....|.|
  Fly   232 LQVLPATLFLFGQV-------------------MFVVCPTLIKIWSICAASHRCVSKSKHLQQQL 277

  Fly   318 ARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQL 378
            ..:.|::...::.|:.|..:.::..:|....|.:.::..||..:|..:...|||.:||..|
  Fly   278 KDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQFVSL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 76/386 (20%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 73/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.