DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr59c

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_726292.1 Gene:Gr59c / 192481 FlyBaseID:FBgn0041235 Length:397 Species:Drosophila melanogaster


Alignment Length:374 Identity:65/374 - (17%)
Similarity:123/374 - (32%) Gaps:132/374 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQ 101
            ||||.|.:.|                                     :.:.|::|.::..:|.| 
  Fly   124 GRWYRRSIIL-------------------------------------KFVFCVLSDSLHTISDV- 150

  Fly   102 NASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQII 166
            :|.|...|...|.|                  |::|.|......:.|..||:.....||      
  Fly   151 SAQRKRITADLIVK------------------LSLLATLTTIFNMIVCQYYLAMVQVIG------ 191

  Fly   167 LLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFR 231
                     ||..||. .||.|:..........|::...:::|.|       .|::.::::.:..
  Fly   192 ---------LYKILLQ-DLRCLVRQAECICSIRNRRGGVYSIQCC-------SLADQLDLIAERH 239

  Fly   232 YITEN----------INCVAGVSLLFYF---GFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIG 283
            |..::          |..:: :||:::|   |..:::|.:..|            |.|....|  
  Fly   240 YFLKDRLDEMSDLFQIQSLS-MSLVYFFSTMGSIYFSVCSILY------------SSTGFGST-- 289

  Fly   284 LSCIWVLAETITMIVICSACD---------GLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSI 339
               .|.|     ::::.|...         .:...:......|.|:......|...:|..|..:.
  Fly   290 ---YWGL-----LLIVLSTASFYMDNWLSVNIGFHIRDQQDELFRVLADRTLFYRELDNRLEAAF 346

  Fly   340 KQ-DLQ-------FTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLED 380
            :. .||       |...|.|.::...|..:.|:|.|:.::|:|::...|
  Fly   347 ENFQLQLASNRHEFYVMGLFKMERGRLIAMLSSVITHTMVLVQWEIQND 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 64/371 (17%)
Gr59cNP_726292.1 7tm_7 9..394 CDD:285581 64/371 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.