DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and egl-47

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001023728.1 Gene:egl-47 / 183687 WormBaseID:WBGene00001211 Length:522 Species:Caenorhabditis elegans


Alignment Length:399 Identity:82/399 - (20%)
Similarity:155/399 - (38%) Gaps:96/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YGRLVALIILIGS--LTLGEDVLFASK-EYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQ 101
            |...:.|.:|:.|  :.:...||...| ::.|:     .|..:...|.....:|:..::|||:::
 Worm   146 YVNYIVLAVLLNSFLIKMNFKVLMLYKHKFGLM-----HTGTVASMITATKPVINVFVIVLSAIK 205

  Fly   102 NASRHFRTLHDIAKIDEYLLANGFRETYSCRN----------LTILVTSAAGGVLAVAFYYIHYR 156
            ..| |.|.|..|..:|..     ||..:....          .|:|:...:..:|.|..:.    
 Worm   206 FKS-HQRLLKTIDMVDVC-----FRSAFGVSPPLRIYKFVFFFTLLIIFFSALILKVVEFV---- 260

  Fly   157 SGIG-------------------AKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQK 202
             |.|                   :...||.||.|.   ||:.|:..|.|||:.::.:     ..|
 Worm   261 -GTGEIFGEHILTDCSFILVPVLSLWNIIPLLYYH---LYNILVRFYCRTLIKSMNR-----EHK 316

  Fly   203 LDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFS-------FYTVTNQS 260
            ...|:|:  .:.|.:..::|          :.|.:..|....|||...:|       .|.::..:
 Worm   317 KRHFSLK--FYYEQFTRITN----------VQEAVGDVFNPLLLFSLAWSLLVLCLTLYFLSEPT 369

  Fly   261 YLAFATLTAGSLSS---KTEVADTIGLSCIW----VLAETITMIVICSACDGLASE------VNG 312
            ......:|...:::   :.::..|:.:...|    |:...:.:|:|||.  |:.:.      ||.
 Worm   370 STLLVPITPEQVTNPKIREKLNITVHVKICWAAYQVVMAILHIIIICST--GMMTNETTRQIVNA 432

  Fly   313 TAQILARIYGKSKQFQNLIDKFLTKSIKQDL-QFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFK 376
            ..:|:........:||  |..|:.|...|.: ..|.:..|.::.:|.|.:.|.:.||.::|.:||
 Worm   433 VLRIVPDANADLDRFQ--ISCFVHKMTTQFMWGMTVWRAFPLERTTFFTLISVIVTYSLLLFRFK 495

  Fly   377 QLEDSKVED 385
               |..|::
 Worm   496 ---DDMVQN 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 80/391 (20%)
egl-47NP_001023728.1 7tm_7 110..495 CDD:303125 78/388 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.