DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr10a

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:392 Identity:75/392 - (19%)
Similarity:148/392 - (37%) Gaps:100/392 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YGRLVALIILIGSLTLGEDVL--FASKEYRLVASAQGDTEEINRTIETLLCI------ISYTMVV 96
            ||.|.::::::        ||  :....:|.:      |:.::|.::.|..:      |.|..|:
  Fly    53 YGHLFSMLLIV--------VLPGYFCYHFRTL------TDTLDRRLQLLFYVSFTNTAIKYATVI 103

  Fly    97 LSSVQNASRHFRTLHDIAKID----EYLLANGFRE-----------TYSCRNLTILVTSAAGGVL 146
            ::.|.| :.||..::....:.    |:...|..:|           .:...||.:::...  |:.
  Fly   104 VTYVAN-TVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFCLINLMMMIQVC--GIF 165

  Fly   147 AVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKL----DTFN 207
            |        :.|...|..:..:.::|  .:|:.:|..|..    |:|....|:|..:    ..||
  Fly   166 A--------QYGEVGKGSVSQVRVHF--AIYAFVLWNYTE----NMADYCYFINGSVLKYYRQFN 216

  Fly   208 LQ-----DCGHMENWR----------ELSNLIEVLCKFRYITENINCVAGVSLLFY----FGFSF 253
            ||     |  .|:..|          |||:.:|.|   |.....|:.:...|...:    .|...
  Fly   217 LQLGSLRD--EMDGLRPGGMLLHHCCELSDRLEEL---RRRCREIHDLQRESFRMHQFQLIGLML 276

  Fly   254 YTVTN---QSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQ 315
            .|:.|   ..|..|..|...||.   ||:..:.:..::.....|...::....:.:..|:...|.
  Fly   277 STLINNLTNFYTLFHMLAKQSLE---EVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVAL 338

  Fly   316 ILARIYGKSKQFQNLIDKFLTKSIKQ-DLQFTAY------GFFSIDNSTLFKIFSAVTTYLVILI 373
            .:.| :.:.::    :|:.||:.|:. .|:...|      |...:|...::.|.....:|.:.|:
  Fly   339 TMRR-FAEPRE----MDERLTREIEHLSLELLNYQPPMLCGLLHLDRRLVYLIAVTAFSYFITLV 398

  Fly   374 QF 375
            ||
  Fly   399 QF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 75/392 (19%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 75/392 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.