DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr22e

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:439 Identity:93/439 - (21%)
Similarity:156/439 - (35%) Gaps:156/439 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SQIFAILPFYSGDVDDGFRFGGLGRW---YGRLV--ALIILIGSLTLGEDVLFASKEYRLVASAQ 73
            |.|..:.||   ..|...|.....:|   ||.::  |.|:|:.:.....:.....:.:...|.| 
  Fly    25 SWILGVFPF---AYDSWTRTLRRSKWLIAYGFVLNAAFILLVVTNDTESETPLRMEVFHRNALA- 85

  Fly    74 GDTEEIN--RTIETLLCI-------------ISYTMVVLSSVQNASRHFR--TLHDIAKIDEYLL 121
               |:||  ..|::|..:             |..|:..|..:|:  |:||  :|.:....|.::|
  Fly    86 ---EQINGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQH--RYFRNYSLEECISFDRFVL 145

  Fly   122 ANGF----------------RETYS----------CRNLTILVTSAAGGVLAVAFYYIHYRSGIG 160
            ..||                ...||          |..|..::..|:...|||.|.|        
  Fly   146 YKGFSVVLELVSMLVLELGMSPNYSAQFFIGLGSLCLMLLAVLLGASHFHLAVVFVY-------- 202

  Fly   161 AKRQIILLLIYFLQLLYSTL-----------LALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHM 214
              |.:.::....|:|:....           |.|||...:::|.||:..:      ::.|     
  Fly   203 --RYVWIVNRELLKLVNKMAIGETVESERMDLLLYLYHRLLDLGQRLASI------YDYQ----- 254

  Fly   215 ENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVA 279
                    ::.|:..|        .:|.| |..|| |..|:::....|.|..|            
  Fly   255 --------MVMVMVSF--------LIANV-LGIYF-FIIYSISLNKSLDFKIL------------ 289

  Fly   280 DTIGLSCIWVLAETITM------IVICSACDGLASEVNGTAQILARIYGKSKQFQNL--IDKFLT 336
                   ::|.|..|.|      :.||...:....:   |:.||       |.|.::  ||:.|.
  Fly   290 -------VFVQALVINMLDFWLNVEICELAERTGRQ---TSTIL-------KLFNDIENIDEKLE 337

  Fly   337 KSI--------KQDLQFTAYGFFSIDNSTLFKIFSAVTT--YLVILIQF 375
            :||        .:.|:|...|.|.::....|::  |:|:  ||:.||||
  Fly   338 RSITDFALFCSHRRLRFHHCGLFYVNYEMGFRM--AITSFLYLLFLIQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 93/439 (21%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 93/439 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450261
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.