DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr28b

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:433 Identity:94/433 - (21%)
Similarity:173/433 - (39%) Gaps:88/433 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIYQDIYPISKPSQIFAILPFY-SGDVDDGFR------FGGLGRWYGRL-VALIILIGSLTL--- 55
            ::|:.:.|:...:.|..:..|| |.|...|.:      ||.:.   |.: :|:.:...|||:   
  Fly    40 QLYECLRPVFHVTYIHGLTSFYISCDTKTGKKAIKKTIFGYIN---GIMHIAMFVFAYSLTIYNN 101

  Fly    56 GEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYL 120
            .|.|  ||..:|...:..||..:|      :...|..|::.|::.....|..|.|.....:|..|
  Fly   102 CESV--ASYFFRSRITYFGDLMQI------VSGFIGVTVIYLTAFVPNHRLERCLQKFHTMDVQL 158

  Fly   121 LANGFRETYS---------CRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLL 176
            ...|.:..||         ..::.::.....||..:|.     |.|.:..     .:.::|..|:
  Fly   159 QTVGVKIMYSKVLRFSYMVLISMFLVNVLFTGGTFSVL-----YSSEVAP-----TMALHFTFLI 213

  Fly   177 YSTLLAL---------YL---RTLMM-----NLAQR-----IGFLNQK------LDTFNLQDCGH 213
            ..|::|:         ||   |.:|:     |||.:     :..:|||      ||:|::.....
  Fly   214 QHTVIAIAIALFSCFTYLVEMRLVMVNKVLKNLAHQWDTRSLKAVNQKQRSLQCLDSFSMYTIVT 278

  Fly   214 MENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTN--------QSYLAFATLTAG 270
            .:....:...:|:        .::.|.|..:...||.:...|:.:        .:|....||...
  Fly   279 KDPAEIIQESMEI--------HHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLLGK 335

  Fly   271 S-LSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIYGKSK--QFQNLID 332
            | ..||.:..:.:......::...|.:|.|....:....:...|..|:..:..|:|  :.:..:.
  Fly   336 SKRESKFKTVEFVTFFSCQMILYLIAIISIVEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEKLQ 400

  Fly   333 KFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375
            :|..:.:...:.|||.|.|:||.:..|.|..|:||||:||:||
  Fly   401 QFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 93/428 (22%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 91/426 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.