DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr22b

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:412 Identity:80/412 - (19%)
Similarity:151/412 - (36%) Gaps:104/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SQIFAILPFYSGDVDDGFRFGGLGR-----WYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQ 73
            |.:..|.||   .:|.|.|...|.|     .||.::...::...:.|.    |..::::|.|..:
  Fly    24 SWLLGIFPF---TLDSGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLA----FEYRKHKLEAFKR 81

  Fly    74 GDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEY---LLANGFRE-------- 127
            ....|:...:..::.::|..:|          ||.......|:.|.   ||...:::        
  Fly    82 NPVLEMINVVIGIINVLSALIV----------HFMNFWGSRKVGEICNELLILEYQDFEGLNGRN 136

  Fly   128 --TYSC----RNLTIL--------VTSAAGGV--------------LAVAFYYIHYRSGIGAKRQ 164
              .::|    :.||||        :..|..|:              .::....:||..|:     
  Fly   137 CPNFNCFVIQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCLMEFSLNLNIMHYHVGV----- 196

  Fly   165 IILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNL-QDCGHMENWRELSNLIEVLC 228
               ||||    .|..|:...|:.|:..|.     ||.:.|...: |.....:...||:..:.:..
  Fly   197 ---LLIY----RYVWLINEQLKDLVSQLK-----LNPETDFSRIHQFLSLYKRLLELNRKLVIAY 249

  Fly   229 KFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAET 293
            :::.....|..::|..::.|| ...|.::.::|..|......||        .|.:...|     
  Fly   250 EYQMTLFIIAQLSGNIVVIYF-LIVYGLSMRTYSIFLVAFPNSL--------LINIWDFW----- 300

  Fly   294 ITMIVIC-SACDGLASEVNGTAQILARIYG----KSKQFQNLIDKFLTKSIKQDLQFTAYGFFSI 353
                 :| :||| |..:......|:.:|:.    :..:.:..:::|......:..:|...|.||:
  Fly   301 -----LCIAACD-LTEKAGDETAIILKIFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSM 359

  Fly   354 DNSTLFKIFSAVTTYLVILIQF 375
            :....||:......|||.|:||
  Fly   360 NCRMGFKMIITTFLYLVYLVQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 80/412 (19%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 80/412 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.