DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr59a

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:384 Identity:74/384 - (19%)
Similarity:138/384 - (35%) Gaps:90/384 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FRFGGLGRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMV 95
            ||...:.|.|..|:..|.    |||.....:  |..:|:::|.. .....|....::|.|:|..:
  Fly    27 FRQSRITRIYCLLINAIF----LTLLPSAFW--KSAKLLSTADW-MPSYMRVTPYIMCTINYAAI 84

  Fly    96 VLSSVQNASRHFR--TLHDIAKI----DEYLLANG---------------FRETYSCRNLTILVT 139
            ..:.:   ||.:|  .|.|:.:|    :..:|..|               |..||||.:.     
  Fly    85 AYTLI---SRCYRDAMLMDLQRIVLEVNREMLRTGKKMNSLLRRMFFLKTFTLTYSCLSY----- 141

  Fly   140 SAAGGVLAVAFY------YIHYRSGIGAKRQIILLLI----YFLQLLYSTLLALYLRTLMMNLAQ 194
                 :|||..|      :.:..:|:.....:.:|.:    ||              |.:.::|:
  Fly   142 -----ILAVFIYQWKAQNWSNLCNGLLVNISLTILFVNTFFYF--------------TSLWHIAR 187

  Fly   195 RIGFLNQKLDTFNLQDCGHME---NWRELSNLIEVLCKFRYITENINCVAGVSLL-FYFGFSFYT 255
            ...|:||:|:  .:..|..|:   ..:||..|..:.....|....||...|..:| ..|.:..::
  Fly   188 GYDFVNQQLN--EIVACQSMDLERKSKELRGLWALHRNLSYTARRINKHYGPQMLAMRFDYFIFS 250

  Fly   256 VTNQSYLAFATLTAGSLSSKTEVADTI----GLSCIWVLAETITMIVICSACDGLASEVNGTAQI 316
            :.|        ...|::.|.|:...::    |....||  .:....:....|| |.||.    |:
  Fly   251 IIN--------ACIGTIYSTTDQEPSLEKIFGSLIYWV--RSFDFFLNDYICD-LVSEY----QM 300

  Fly   317 LARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375
            ..:.:.......|.:..:|.......|.....|.:.::.....::..::..:..:|.||
  Fly   301 QPKFFAPESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 74/384 (19%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 74/384 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.