DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr59b

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:381 Identity:81/381 - (21%)
Similarity:131/381 - (34%) Gaps:122/381 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRE 127
            |:.|.|:|:           |.||:.:    .:|:..||...:..:|...:     .|:.|..||
  Fly    34 SRTYALIAN-----------IVTLIML----PIVMWQVQLVFQQKKTFPKL-----ILITNNVRE 78

  Fly   128 TYSCRNLTILVTSAAGGVLAVAFYYIH------YR-------SGIGAKRQIILLLIY-------- 171
            ..|.  |.||.|..:.|....||..:.      :|       .|||..|:.:.:|::        
  Fly    79 AVSF--LVILYTVLSRGFRDTAFKEMQPLLLTLFREEKRCGFKGIGGVRRSLRILLFVKFFTLSW 141

  Fly   172 -----FLQLLYSTLLALYLRTL----------------------MMNLAQRIGFLNQKLDTFNLQ 209
                 .|.|||||...:::..|                      :.::|:....:|::||  .:.
  Fly   142 LCVTDVLFLLYSTDALIWVNVLRFFFKCNTNNILEMVPMGYFLALWHIARGFDCVNRRLD--QIV 204

  Fly   210 DCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSS 274
            ........|||.:|..:.........|||.:....:|              ...|.....|.:.:
  Fly   205 KSKSTRKHRELQHLWLLHACLTKTALNINKIYAPQML--------------ASRFDNFVNGVIQA 255

  Fly   275 KTEVADTIGLSC--IWVLAETITMIVIC-------SACDGLA----------SEVNGTAQILAR- 319
            ......|..||.  .||:..::...|.|       :.||...          |||..|.:|.:. 
  Fly   256 YWGAVFTFDLSTPFFWVVYGSVQYHVRCLDYYLIDNMCDVAVEYHDSAKHSWSEVRWTKEISSYV 320

  Fly   320 IYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375
            ||..|           ||     ||..:.|.|..:.|..|.:.|:|..|:::|:||
  Fly   321 IYANS-----------TK-----LQLWSCGLFQANRSMWFAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 81/381 (21%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 81/381 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.