DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr68a and Gr22f

DIOPT Version :9

Sequence 1:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:370 Identity:68/370 - (18%)
Similarity:140/370 - (37%) Gaps:75/370 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RWYGRLVALIILIG------SLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIIS----Y 92
            ||       ::|.|      ::.|......|||:.|     :.:..|.|..:|.:.....    :
  Fly    47 RW-------LLLYGFVLHSLAMCLAMSSHLASKQRR-----KYNAFERNPLLEKIYMQFQVTTFF 99

  Fly    93 TMVVL--------SSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTS---AAGGVL 146
            |:.||        ::|:..:....||....| |...|.|       |.|....|..   ||.|..
  Fly   100 TISVLLLMNVWKSNTVRKIANELLTLEGQVK-DLLTLKN-------CPNFNCFVIKKHVAAIGQF 156

  Fly   147 AVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDC 211
            .::.|:...:.....|   ||.::..|..:...|:.::..|.::.:.:.:..:|:     .|:|.
  Fly   157 VISIYFCLCQENSYPK---ILKILCCLPSVGLQLIIMHFHTEIILVYRYVWLVNE-----TLEDS 213

  Fly   212 GHMENWR--ELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSS 274
            .|:.:.|  .|::|.:.|.|...:....|.:..:.:|.     .|.:.|...:.|..:...|::.
  Fly   214 HHLSSSRIHALASLYDRLLKLSELVVACNDLQLILMLI-----IYLIGNTVQIFFLIVLGVSMNK 273

  Fly   275 KTEVADTIGLSCIWVLAETITM---------IVICSACDGLASEVNGTAQILARIYGKSKQFQNL 330
            :          .|:::|....:         ||:|........:.:...::...:....::.:..
  Fly   274 R----------YIYLVASPQLIINFWDFWLNIVVCDLAGKCGDQTSKVLKLFTDLEHDDEELERS 328

  Fly   331 IDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQF 375
            :::|......:..:|...|.|||:::..|::......|||.|:||
  Fly   329 LNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQF 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 68/370 (18%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 68/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.