DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32087 and c-cup

DIOPT Version :9

Sequence 1:NP_729740.2 Gene:CG32087 / 39323 FlyBaseID:FBgn0052087 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_608623.2 Gene:c-cup / 33360 FlyBaseID:FBgn0031367 Length:201 Species:Drosophila melanogaster


Alignment Length:131 Identity:26/131 - (19%)
Similarity:47/131 - (35%) Gaps:38/131 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 GKALIKATIQQLFVIASLTESLVDRFVVGLGKLPY-LGPPMQRMIRELLQSTKQQMHGT------ 336
            |..::..|:::|......:.||  .....|..|.| |.|.     ||...|     ||.      
  Fly    80 GHDIVLLTLEELTAFDGSSPSL--PIYTALNGLIYDLSPG-----REKFSS-----HGPYSLLAG 132

  Fly   337 VNSNSLAYLSHLVRAFELCAFIMVTCFVVSSLN-CLAQIHCKRQQEKKRKMRNLEMILYADTETS 400
            .|:|.:               :.:.|   ||:. |.|.:..:.:|..:.:.:.:..::.||.:..
  Fly   133 CNANKV---------------LNIAC---SSMGVCAANVISRWEQSLRAEFKVVGYLVDADIDII 179

  Fly   401 S 401
            |
  Fly   180 S 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32087NP_729740.2 SNARE_assoc <233..282 CDD:294297 1/2 (50%)
c-cupNP_608623.2 Cyt-b5 87..>115 CDD:295147 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.