DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32087 and MSBP

DIOPT Version :9

Sequence 1:NP_729740.2 Gene:CG32087 / 39323 FlyBaseID:FBgn0052087 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster


Alignment Length:41 Identity:8/41 - (19%)
Similarity:23/41 - (56%) Gaps:8/41 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QQMHGTVNSNSLAYLSHLVRAFEL------CAFIMVTCFVV 365
            :::...:|::..::|.:::|  |:      .|.:.:.||:|
  Fly    15 KEIGNNLNNDDSSFLGNIIR--EILYSPMNLALLAIICFLV 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32087NP_729740.2 SNARE_assoc <233..282 CDD:294297
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.