powered by:
Protein Alignment CG32087 and MSBP
DIOPT Version :9
Sequence 1: | NP_729740.2 |
Gene: | CG32087 / 39323 |
FlyBaseID: | FBgn0052087 |
Length: | 407 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001162765.1 |
Gene: | MSBP / 32548 |
FlyBaseID: | FBgn0030703 |
Length: | 248 |
Species: | Drosophila melanogaster |
Alignment Length: | 41 |
Identity: | 8/41 - (19%) |
Similarity: | 23/41 - (56%) |
Gaps: | 8/41 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 QQMHGTVNSNSLAYLSHLVRAFEL------CAFIMVTCFVV 365
:::...:|::..::|.:::| |: .|.:.:.||:|
Fly 15 KEIGNNLNNDDSSFLGNIIR--EILYSPMNLALLAIICFLV 53
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32087 | NP_729740.2 |
SNARE_assoc |
<233..282 |
CDD:294297 |
|
MSBP | NP_001162765.1 |
Cyt-b5 |
82..180 |
CDD:278597 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45452926 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10281 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.