DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32087 and MSBP

DIOPT Version :10

Sequence 1:NP_729740.2 Gene:CG32087 / 39323 FlyBaseID:FBgn0052087 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_573087.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster


Alignment Length:41 Identity:8/41 - (19%)
Similarity:23/41 - (56%) Gaps:8/41 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QQMHGTVNSNSLAYLSHLVRAFEL------CAFIMVTCFVV 365
            :::...:|::..::|.:::|  |:      .|.:.:.||:|
  Fly    15 KEIGNNLNNDDSSFLGNIIR--EILYSPMNLALLAIICFLV 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32087NP_729740.2 DedA <165..304 CDD:481177
SNARE_assoc <233..282 CDD:469768
MSBPNP_573087.1 Cyt-b5 84..152 CDD:459698
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.