DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and OAC1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_012802.1 Gene:OAC1 / 853739 SGDID:S000001603 Length:324 Species:Saccharomyces cerevisiae


Alignment Length:316 Identity:97/316 - (30%)
Similarity:151/316 - (47%) Gaps:39/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLR 67
            ::..:..||.||:|:..|...|.||:..|.|:|:||: :..|.::: |:........|.:.||::
Yeast    19 KISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGE-MSASAAKV-YKNPIQGMAVIFKNEGIK 81

  Fly    68 ALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWS---NILCAAAAGAISSA 129
            .|..|:..|.:.|......:.|.|..::...|:  |...:....:|.|   |:...||:|.|.:.
Yeast    82 GLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQ--LFFPDQEPHKVQSVGVNVFSGAASGIIGAV 144

  Fly   130 IANPTDVLKVRM-----------QVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIA 183
            |.:|..::|.|:           |.|..|...||:    .|:|.|||:||:||:.....|....:
Yeast   145 IGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLV----TIFKTEGVKGLFRGIDAAILRTGAGS 205

  Fly   184 SVELPVYDFCKLQLM--NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGV 246
            ||:||:|:..|..|:  :...|....|..:|.|:.||.|:...|.|||.||:.||:         
Yeast   206 SVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK--------- 261

  Fly   247 VTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
                  ..||.|.:||.|:|:|.||:.||||||.....|:.|..|:.....||..|
Yeast   262 ------GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 25/89 (28%)
Mito_carr <132..199 CDD:278578 25/79 (32%)
Mito_carr 204..303 CDD:278578 36/99 (36%)
OAC1NP_012802.1 PTZ00169 26..294 CDD:240302 91/290 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1382
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.890

Return to query results.
Submit another query.