DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and DIC1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_013452.1 Gene:DIC1 / 851063 SGDID:S000004340 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:93/310 - (30%)
Similarity:143/310 - (46%) Gaps:51/310 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGI 73
            |:.|||.|.|.|...|.|:|..|.|||.........|..|.         .|...||:..||||:
Yeast    16 PWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLE---------SILANEGVVGLYSGL 71

  Fly    74 WPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNIL-CAAAAGAISSAIANPTDVL 137
            ..|||||.||.|::||.|..||:....|..|.|       .:.:| |:..:|||.....|..||:
Yeast    72 SAAVLRQCTYTTVRFGAYDLLKENVIPREQLTN-------MAYLLPCSMFSGAIGGLAGNFADVV 129

  Fly   138 KVRMQ------VHGKGQHKGLLGCFGEIYKYE-GVRGLWRGVGPTAQRAVVIASVELPVYDFCKL 195
            .:|||      ...:..:|..:....:||:|| |::.|:.|..|...|.:::.:.::..||..|.
Yeast   130 NIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYDVFKN 194

  Fly   196 QLMNAFG-DHVGN--HFISSFIASLGSAIASTPIDVIRTRLMN----QRPVSITMNGVVTAAATP 253
            .|:.... |...|  |..:|.:|.|.:....:|.||::||:||    .:|               
Yeast   195 YLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQP--------------- 244

  Fly   254 KLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
                 :|......:|.||...:::|::|::.|:||:.::.|...|||||:
Yeast   245 -----ALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKKH 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 36/87 (41%)
Mito_carr <132..199 CDD:278578 20/73 (27%)
Mito_carr 204..303 CDD:278578 27/104 (26%)
DIC1NP_013452.1 Mito_carr 20..94 CDD:395101 33/82 (40%)
Mito_carr 100..200 CDD:395101 27/106 (25%)
Mito_carr 203..289 CDD:395101 28/105 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.