DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and SLC25A11

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_024306762.1 Gene:SLC25A11 / 8402 HGNCID:10981 Length:342 Species:Homo sapiens


Alignment Length:333 Identity:102/333 - (30%)
Similarity:150/333 - (45%) Gaps:64/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74
            |::||:|.:.|.....|:|..|.|:|:.|    :......|:....|...|.:.||||.:|:|.|
Human    25 FLFGGLAGMGATVFVQPLDLVKNRMQLSG----EGAKTREYKTSFHALTSILKAEGLRGIYTGYW 85

  Fly    75 ----------------------------PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSE 111
                                        ..:||||||.|.:.|.|..|    .||  |...||:.
Human    86 GLRMEGRLWVGSSRPWPDMLTPLLLRLSAGLLRQATYTTTRLGIYTVL----FER--LTGADGTP 144

  Fly   112 RVWSNILCAA----AAGAISSAIANPTDVLKVRMQVHGK---GQHKGLLGCFG---EIYKYEGVR 166
               ...|..|    .|||..:.:..|.:|..:||...|:   .|.:|....|.   .|.:.|||.
Human   145 ---PGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVL 206

  Fly   167 GLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVI 229
            .||||..||..||||:.:.:|..|...|..|:::  |.|::..||.:|.|:.|.:..||.|:|:.
Human   207 TLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIA 271

  Fly   230 RTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFF 294
            :||:.|.|.:.          ..|: |...||...:.:|.||..:|:|||.|.:.|:||..::.|
Human   272 KTRIQNMRMID----------GKPE-YKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTF 325

  Fly   295 ITYEQLKK 302
            |..||:.|
Human   326 IFLEQMNK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 31/114 (27%)
Mito_carr <132..199 CDD:278578 26/72 (36%)
Mito_carr 204..303 CDD:278578 33/99 (33%)
SLC25A11XP_024306762.1 Mito_carr 24..>85 CDD:278578 20/63 (32%)
Mito_carr 144..241 CDD:278578 31/99 (31%)
Mito_carr 243..337 CDD:278578 35/102 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.