DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and ucp1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_955817.1 Gene:ucp1 / 83908 ZFINID:ZDB-GENE-010503-1 Length:309 Species:Danio rerio


Alignment Length:297 Identity:102/297 - (34%)
Similarity:165/297 - (55%) Gaps:29/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVASITAEFGTFPIDTTKTRLQIQGQK-IDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAV 77
            |.|:..|:..|||:||.|.||||||:| :..:...:||:|:......:.|.||.|:||:|:...:
Zfish    21 GTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRTEGPRSLYNGLVAGL 85

  Fly    78 LRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVR-- 140
            .||..:.:|:.|.|..:|.... ||     ..:..|...||.....||::.::|.||||:|||  
Zfish    86 QRQMAFASIRIGLYDNVKSFYT-RG-----K
DNPNVAVRILAGCTTGAMAVSMAQPTDVVKVRFQ 144

  Fly   141 --MQVHGKG-QHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLM--NA 200
              |.:.|.| ::.|.:..:.:|::.||:||||:|..|...|..::...||..||..|..::  ..
Zfish   145 AQMNLQGVGRRYNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRL 209

  Fly   201 FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQ 265
            ..|::..||:|:|.|...:.:.::|:||::||.||               :.|..||.|.:||..
Zfish   210 LSDNLPCHFVSAFGAGFITTVIASPVDVVKTRYMN---------------SPPGQYSSSTNCAWT 259

  Fly   266 TIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            .:..||..|.||||:|:::|:|.||::.|:::||||:
Zfish   260 MLTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/83 (39%)
Mito_carr <132..199 CDD:278578 26/73 (36%)
Mito_carr 204..303 CDD:278578 35/99 (35%)
ucp1NP_955817.1 Mito_carr 10..110 CDD:395101 34/94 (36%)
Mito_carr 111..208 CDD:395101 32/96 (33%)
Mito_carr 213..299 CDD:395101 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.