DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and UCP3

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 / 837973 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana


Alignment Length:300 Identity:105/300 - (35%)
Similarity:164/300 - (54%) Gaps:36/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLR 79
            ::::.||..|||||.||||:|:.|   ..|.|.....|......:|:|:||:..||.|:.||::|
plant    21 LSAMVAESVTFPIDLTKTRMQLHG---SGSASGAHRIGAFGVVSEIARKEGVIGLYKGLSPAIIR 82

  Fly    80 QATYGTIKFGTYYTLKKLANERGLLI----NEDGSERVWSNILCAAAAGAISSAIANPTDVLKVR 140
            ...|..|:...|..||      ||::    |...|..:.:..|....:|.|:..:|:|.|::|||
plant    83 HLFYTPIRIIGYENLK------GLIVRS
ETNNSESLPLATKALVGGFSGVIAQVVASPADLVKVR 141

  Fly   141 MQVHG-------KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLM 198
            ||..|       |.::.|.:..|.:|.:.|||:|||:||.|..|||.::...||..||..|..::
plant   142 MQADGRLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGELACYDHAKHFVI 206

  Fly   199 N--AFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLD 261
            :  ...|::..|.::|.::.|.|...|.|.||::||:|||...::              |..|.|
plant   207 DKK
IAEDNIFAHTLASIMSGLASTSLSCPADVVKTRMMNQGENAV--------------YRNSYD 257

  Fly   262 CAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLK 301
            |.|:|::.||:.||:|||.|||.|:|||..:|:::||:.:
plant   258 CLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYEKFR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 31/81 (38%)
Mito_carr <132..199 CDD:278578 29/73 (40%)
Mito_carr 204..303 CDD:278578 36/97 (37%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:395101 33/91 (36%)
Mito_carr 110..209 CDD:395101 34/98 (35%)
Mito_carr 212..299 CDD:395101 37/99 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.