DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and UCP2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 / 836014 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana


Alignment Length:312 Identity:106/312 - (33%)
Similarity:159/312 - (50%) Gaps:36/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQ--LRYRGMTDAFVKISREEG 65
            |:.....|:....|:..||..|.|:||.|.|||:| :||.....:  .:|||.......|:||||
plant     9 EISFLETFICSAFAACFAELCTIPLDTAKVRLQLQ-RKIPTGDGENLPKYRGSIGTLATIAREEG 72

  Fly    66 LRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINED--GSERVWSNILCAAAAGAISS 128
            :..|:.|:...:.||..||.::.|.|..:|.      ||:..|  |...::..||.|...|||:.
plant    73 ISGLWKGVIAGLHRQCIYGGLRIGLYEPVKT------LLVGSDFIGDIPLYQKILAALLTGAIAI 131

  Fly   129 AIANPTDVLKVRMQVHGK------GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVEL 187
            .:|||||::|||:|..||      .::.|.:..:..|.|.|||..||.|:||...|..::.:.||
plant   132 IVANPTDLVKVRLQSEGKLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGLGPNIARNAIVNAAEL 196

  Fly   188 PVYDFCKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAA 250
            ..||..|..:|..  |.|.|..|.::...|...:....:||||:::|:|..              
plant   197 ASYDQIKETIMKIPFFRDSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMMGD-------------- 247

  Fly   251 ATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
               ..|..::||.::|::.||:.|.||||:|.:.|:|.||.|.|:|.||:||
plant   248 ---STYRNTVDCFIKTMKTEGIMAFYKGFLPNFTRLGTWNAIMFLTLEQVKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/91 (35%)
Mito_carr <132..199 CDD:278578 27/72 (38%)
Mito_carr 204..303 CDD:278578 32/99 (32%)
UCP2NP_568894.1 PTZ00169 11..296 CDD:240302 103/308 (33%)
Mito_carr 212..300 CDD:395101 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.