DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and PNC2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_198104.1 Gene:PNC2 / 832812 AraportID:AT5G27520 Length:321 Species:Arabidopsis thaliana


Alignment Length:348 Identity:78/348 - (22%)
Similarity:137/348 - (39%) Gaps:103/348 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGVASITAEFGTFPIDTTKTRLQ----IQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGI 73
            |.:.|:.:....:|:||.|::.|    ::||:        :||.::|.|.:......:.:||.|:
plant    16 GAIGSLLSTTILYPLDTCKSKFQAEIRVRGQQ--------KYRYLSDVFWEAISSGNVLSLYQGL 72

  Fly    74 WPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVW--SNILCAAAAGAISSAIANPTDV 136
            ....|:......|.|.:|...|:|.::|      .||:.:.  :|:|.||||||.:|.:..|.|.
plant    73 GTKNLQSFISSFIYFYSYSYFKRL
HSQR------IGSKSIGTKANLLIAAAAGACTSVLTQPLDT 131

  Fly   137 LKVRMQVHGKGQHKGLL-----GCFGEIYKYEGVRGLWRGVGPTAQRAVVIAS---VELPVYDFC 193
            ...|||....|:.|||.     |.:|..:...|:             ::::.|   ::..|:|..
plant   132 ASSRMQTSEFGKSKGLWKTLTDGSWGNAFDGLGI-------------SLLLTSNPAIQYTVFDQL 183

  Fly   194 KLQLMNAFGDHVGNH-----FISSFIASLGSAIASTPIDV-----IRTRLMNQ------------ 236
            |..|:.. |....|.     .:|:|:|.:..|::.:...|     ||.::|.|            
plant   184 KQNLLEK-G
KAKSNKDSSPVVLSAFMAFVLGAVSKSAATVITYPAIRCKVMIQAADDSKENEAKK 247

  Fly   237 --RPVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKG----------------FIPTW 283
              :.:..|:.|||.|                ..:.||:...:||                .|...
plant   248 PRKRIRKTIPGVVYA----------------IWKKEGILGFFKGLQAQILKTVLSSALLLMIKEK 296

  Fly   284 VRMGPWNII-----FFITYEQLK 301
            :....|.:|     .|:|..:||
plant   297 ITATTWILILAIRTLFVTKARLK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 21/87 (24%)
Mito_carr <132..199 CDD:278578 17/74 (23%)
Mito_carr 204..303 CDD:278578 26/143 (18%)
PNC2NP_198104.1 Mito_carr 6..96 CDD:395101 21/87 (24%)
Mito_carr 110..191 CDD:395101 26/94 (28%)
Mito_carr 204..297 CDD:395101 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.