DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and AT5G19760

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:308 Identity:90/308 - (29%)
Similarity:140/308 - (45%) Gaps:43/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPFVYGGVASITAEFGTFPIDTTKTRLQI-QGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYS 71
            :|||.||.:.:.|.....|||..|.|:|: ||.....:.:.|             :.||:.|.|.
plant    16 KPFVNGGASGMLATCVIQPIDMIKVRIQLGQGSAASITTNML-------------KNEGVGAFYK 67

  Fly    72 GIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDV 136
            |:...:||||||.|.:.|::    ||...:.:..|:.....::...||...||||.:.:.:|.|:
plant    68 GLSAGLLRQATYTTARLGSF
----KLLTAKAIESNDGKPLPLYQKALCGLTAGAIGACVGSPADL 128

  Fly   137 LKVRMQVHGK---GQHKGLLGCFGEIYKY---EGVRGLWRGVGPTAQRAVVIASVELPVYDFCKL 195
            ..:|||....   .|.:.....|..:.:.   |||..||:|.|||..||:.:....|..||....
plant   129 ALIRMQADNTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAMALNMGMLASYDQSAE 193

  Fly   196 QLMN--AFGDH---VGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKL 255
            .:.:  .||:.   ||...:|.|.|    |..|.|.|.::|::...:|          .|.....
plant   194 YMRDNL
GFGEMSTVVGASAVSGFCA----AACSLPFDFVKTQIQKMQP----------DAQGKYP 244

  Fly   256 YSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            |:||||||::|::..|....|.||....||:.|..::.:|...|:.|:
plant   245 YTGSLDCAMKTLKEGGPLKFYSGFPVYCVRIAPHVMMTWIFLNQITKF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 28/89 (31%)
Mito_carr <132..199 CDD:278578 21/72 (29%)
Mito_carr 204..303 CDD:278578 29/101 (29%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 28/83 (34%)
Mito_carr 101..199 CDD:395101 27/97 (28%)
Mito_carr 210..292 CDD:395101 27/95 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.