DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and DIC2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:325 Identity:109/325 - (33%)
Similarity:159/325 - (48%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKID----------------------QSFSQLRY 50
            :.||.||:||:.|...|.|:|..|.|||:.|:...                      ::.|.:..
plant     4 KSFVEGGIASVIAGCSTHPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVPK 68

  Fly    51 RGMTDAFVKISREEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWS 115
            .|.....:.|.:.||..||:||:...:|||..|.|.:.|.|..||....:     .|.|...:..
plant    69 VGPISLGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTD-----PESGKLNLSR 128

  Fly   116 NILCAAAAGAISSAIANPTDVLKVRMQVHGK---GQHKGLLG---CFGEIYKYEGVRGLWRGVGP 174
            .|.....||.|.:|:.||.||..||||..|:   .|.:...|   ....:.|.|||..||||...
plant   129 KIGAGLVAGGIGAAVGNPADVAMVRMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSAL 193

  Fly   175 TAQRAVVIASVELPVYDFCKLQLM--NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQR 237
            |..||:::.:.:|..||..|..::  ....|.:|.|.::||.|...:::||.|:|||:||:||.:
plant   194 TINRAMIVTAAQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKTRVMNMK 258

  Fly   238 PVSITMNGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
                     |.|      |.|:.||||:|::.||..||||||:||..|.||:.::.|:|.||::|
plant   259 ---------VGA------YDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVRK 308

  Fly   303  302
            plant   309  308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 33/110 (30%)
Mito_carr <132..199 CDD:278578 26/74 (35%)
Mito_carr 204..303 CDD:278578 42/99 (42%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 33/113 (29%)
Mito_carr 122..220 CDD:395101 32/97 (33%)
Mito_carr 225..312 CDD:395101 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2689
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.