DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and AT4G03115

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001329297.1 Gene:AT4G03115 / 828074 AraportID:AT4G03115 Length:346 Species:Arabidopsis thaliana


Alignment Length:304 Identity:102/304 - (33%)
Similarity:149/304 - (49%) Gaps:47/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQ--GQK---IDQSFSQLRYRGMTDAFVKISREEGLRAL 69
            |...|::...|...|.|:|..|.|||:|  ||:   |          |||..|:::.:.||.|:|
plant    70 FGISGISVALATGVTHPLDVVKVRLQMQHVGQRGPLI----------GMTGIFLQLMKNEGRRSL 124

  Fly    70 YSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINED---GSERVWSNILCAAAAGAISSAIA 131
            |.|:.||:.|...||.::.|.|...|         ::.|   ||..|...|...|.|||.|:|:.
plant   125 YLGLTPALTRSVLYGGLRLGLYEPTK---------VSFDWAFGSTNVLVKIASGAFAGAFSTALT 180

  Fly   132 NPTDVLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQ 196
            ||.:|:|||:|::.....   :....||...||:..||:||||...||..:.:.:|..||..|..
plant   181 NPVEVVKVRLQMNPNAVP---IAEVREIVSKEGIGALWKGVGPAMVRAAALTASQLATYDEAKRI 242

  Fly   197 LMNAF----GDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYS 257
            |:...    |.|:  |..||.:|.|.|.:.:.|:|:|:||||.|:           .:.:.|.|.
plant   243 LVKRTSLEEGFHL--HLCSSVVAGLVSTLITAPMDMIKTRLMLQQ-----------GSESTKTYR 294

  Fly   258 GSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLK 301
            ....|..:.:|.||..|||||....:.|:||..:|.||..|:|:
plant   295 NGFHCGYKVVRKEGPLALYKGGFAIFARLGPQTMITFILCEKLR 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/91 (35%)
Mito_carr <132..199 CDD:278578 24/66 (36%)
Mito_carr 204..303 CDD:278578 34/98 (35%)
AT4G03115NP_001329297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103926
Panther 1 1.100 - - LDO PTHR45618
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.