DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and PNC1

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_566251.1 Gene:PNC1 / 819693 AraportID:AT3G05290 Length:322 Species:Arabidopsis thaliana


Alignment Length:294 Identity:70/294 - (23%)
Similarity:123/294 - (41%) Gaps:62/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAV 77
            |.:.|:.:....:|:||.|::.|.:    .::..|.:||.::|...:...:..:.:||.|:....
plant    14 GAIGSLLSTTILYPLDTCKSKFQAE----VRARGQQKYRYLSDVMWEAISKGQVFSLYQGLGTKN 74

  Fly    78 LRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVW--SNILCAAAAGAISSAIANPTDVLKVR 140
            .:......|.|.:|...|::.:||      .||:.:.  :|:|.||||||.:|.:..|.|....|
plant    75 FQSFISQFIYFYSYSYFKRV
HSER------TGSKSIGTKANLLIAAAAGACTSVLIQPLDTASSR 133

  Fly   141 MQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIAS---VELPVYDFCKLQLM---N 199
            ||....|:.|||.....|        |.|.........::::.|   ::..|:|..|..|:   |
plant   134 MQTSEFGESKGLWKTLTE--------GSWADAFDGLGISLLLTSNPAIQYTVFDQLKQHLLKQKN 190

  Fly   200 AFGDHVGNHFI-SSFIASLGSAIASTPIDV-----IRTRLMNQ--------------RPVSITMN 244
            |..::..:..: |:|:|.:..|::.:...|     ||.::|.|              |....|:.
plant   191 AKAENGSSPVVLSAFMAFVLGAVSKSVATVLTYPAIRCKVMIQAADESKENETKKPRRRTRKTIP 255

  Fly   245 GVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKG 278
            |||.|                ..|.||:...:||
plant   256 GVVYA----------------IWRKEGMLGFFKG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 18/83 (22%)
Mito_carr <132..199 CDD:278578 17/72 (24%)
Mito_carr 204..303 CDD:278578 20/95 (21%)
PNC1NP_566251.1 Mito_carr 4..94 CDD:395101 18/83 (22%)
Mito_carr 108..189 CDD:395101 26/88 (30%)
Mito_carr 202..295 CDD:395101 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.