DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and UCP5

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:319 Identity:114/319 - (35%)
Similarity:166/319 - (52%) Gaps:44/319 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYR------------------GMTDA 56
            |..||:|||.|...|.|:|..|.|:|:||:...   .|...|                  |:...
plant     6 FAEGGIASIVAGCSTHPLDLIKVRMQLQGESAP---IQTNLRPALAFQTSTTVNAPPLRVGVIGV 67

  Fly    57 FVKISREEGLRALYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAA 121
            ..::.||||:|||:||:...||||..|.|.:.|.|..:|....:     .|..:..:...|...|
plant    68 GSRLIREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIKGEWTD-----PETKTMPLMKKIGAGA 127

  Fly   122 AAGAISSAIANPTDVLKVRMQVHG------KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAV 180
            .||||.:|:.||.||..||||..|      :..:|.:|....::.:.|||..||||...|..||:
plant   128 IAGAIGAAVGNPADVAMVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAM 192

  Fly   181 VIASVELPVYDFCKLQLM--NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITM 243
            ::.|.:|..||..|..::  ....|.:|.|..:||.|...:::||.|:|||:||:||.:      
plant   193 LVTSSQLASYDSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMK------ 251

  Fly   244 NGVVTAAATPKLYSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
              ||...|.|  |.|::|||::|::.||:.:||||||||..|..|:.::.|:|.||:||
plant   252 --VVAGVAPP--YKGAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 36/104 (35%)
Mito_carr <132..199 CDD:278578 26/74 (35%)
Mito_carr 204..303 CDD:278578 43/99 (43%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 35/102 (34%)
Mito_carr <136..213 CDD:395101 26/76 (34%)
Mito_carr 216..311 CDD:395101 44/101 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2689
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.