DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a27

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_017173167.1 Gene:Slc25a27 / 74011 MGIID:1921261 Length:344 Species:Mus musculus


Alignment Length:286 Identity:101/286 - (35%)
Similarity:152/286 - (53%) Gaps:27/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TFPIDTTKTRLQIQGQKI-----DQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVLRQATY 83
            |||:|.||||||:||:..     |.:.....||||....:.|.:|||...|:.|:.||:.|...|
Mouse    50 TFPLDLTKTRLQMQGEAALARLGDGAVDSAPYRGMVRTALGIVQEEGFLKLWQGVTPAIYRHVVY 114

  Fly    84 GTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVRMQVHGKG- 147
            ...:..||..|:::...:    :||....:|.:::....||.|...:|||||::||:||:.||. 
Mouse   115 SGGRMVTYEHLREVVFG
K----SEDKHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRR 175

  Fly   148 ------QHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK--LQLMNAFGDH 204
                  :.:|:...|.:|....|:||||.|..|..|||.::...:|..||..|  |.|.....|:
Mouse   176 LEGKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTVKHYLV
LNTPLEDN 240

  Fly   205 VGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCAVQTIRN 269
            :..|.:||..:.|.::|..||.|||::|:||| |......|:        ||..|.||.:|.::.
Mouse   241 ISTHGLSSLCSGLVASILGTPADVIKSRIMNQ-PRDKQGRGL--------LYKSSADCLIQAVQG 296

  Fly   270 EGLPALYKGFIPTWVRMGPWNIIFFI 295
            ||..:|||||:|:|:||.....:.|:
Mouse   297 EGFLSLYKGFLPSWLRMVKMGEVLFL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/77 (39%)
Mito_carr <132..199 CDD:278578 29/75 (39%)
Mito_carr 204..303 CDD:278578 34/92 (37%)
Slc25a27XP_017173167.1 Mito_carr 48..131 CDD:365909 30/80 (38%)
Mito_carr 138..232 CDD:365909 32/93 (34%)
Mito_carr 240..>314 CDD:365909 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.