DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and UCP2

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:307 Identity:96/307 - (31%)
Similarity:160/307 - (52%) Gaps:43/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKID--QSFSQLRYRGMTDAFVKISREEGLRA 68
            |||   :.|..:       :|.......|||||:...  ::.:..:|||:....:.:.|.||.|:
Human    24 DWR---WEGQHA-------YPCSYPVLALQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRS 78

  Fly    69 LYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSER--VWSNILCAAAAGAISSAIA 131
            ||:|:...:.||.::.:::.|.|.::|:...:        |||.  :.|.:|..:..||::.|:|
Human    79 LYNGLVAGLQRQMSFASVRIGLYDSVKQFYTK--------GSEHASIGSRLLAGSTTGALAVAVA 135

  Fly   132 NPTDVLKVRMQVH----GKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDF 192
            .||||:|||.|..    |..:::..:..:..|.:.||.||||:|..|...|..::...||..||.
Human   136 QPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDL 200

  Fly   193 CKLQLM--NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKL 255
            .|..|:  |...|.:..||.|:|.|...:.:.::|:||::||.||               :....
Human   201 IKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMN---------------SALGQ 250

  Fly   256 YSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            ||.:..||:..::.||..|.||||:|:::|:|.||::.|:||||||:
Human   251 YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 24/91 (26%)
Mito_carr <132..199 CDD:278578 25/72 (35%)
Mito_carr 204..303 CDD:278578 35/99 (35%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 20/77 (26%)
Mito_carr 113..207 CDD:278578 32/93 (34%)
Mito_carr 218..300 CDD:278578 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.