DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a35

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_082324.1 Gene:Slc25a35 / 71998 MGIID:1919248 Length:300 Species:Mus musculus


Alignment Length:305 Identity:91/305 - (29%)
Similarity:141/305 - (46%) Gaps:24/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74
            |:..|||:..|...|.|::..|||:|:||:.......|..||.:..||..|.:.:||.||..|:.
Mouse     3 FLMSGVAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFFTIGKVDGLAALQKGLG 67

  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139
            ||:|.|.....|:.|||    .||..||.|...:|:.....:....|.||.:.:.:.:|..::|.
Mouse    68 PALLYQFLMNGIRLGTY----GLAESR
GYLHTNEGTHSPVRSAAAGALAGVMGAYLGSPIYMVKT 128

  Fly   140 RMQVHGKGQ--------HKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK-- 194
            .:|.....:        |:|:.....||.:..|:.|||||......|.|:.:|.:|..:...|  
Mouse   129 HLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGAVGGLPRVVIGSSTQLCTFSSIKDL 193

  Fly   195 LQLMNAFGDHVGN-HFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSG 258
            |.....|...... ...::.::.:...:|.||.||..|||.|| |......|:        :|.|
Mouse   194 L
SQWEIFPPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQ-PTDTRGKGL--------MYRG 249

  Fly   259 SLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            .||..:||.|.||...:|||...::.|:||..|:....::||:.:
Mouse   250 ILDALLQTARTEGFFGMYKGIGASYFRLGPHTILSLFFWDQLRSF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/86 (37%)
Mito_carr <132..199 CDD:278578 19/76 (25%)
Mito_carr 204..303 CDD:278578 30/99 (30%)
Slc25a35NP_082324.1 Solcar 1 1..90 34/90 (38%)
Mito_carr 2..84 CDD:365909 30/80 (38%)
Solcar 2 100..193 21/92 (23%)
Mito_carr 101..194 CDD:365909 21/92 (23%)
Solcar 3 203..294 30/99 (30%)
Mito_carr 209..297 CDD:365909 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.