DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a30

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_006519518.1 Gene:Slc25a30 / 67554 MGIID:1914804 Length:311 Species:Mus musculus


Alignment Length:269 Identity:149/269 - (55%)
Similarity:183/269 - (68%) Gaps:17/269 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALY 70
            :|:||||||:||||||.||||||.||||||||||..|.:|.::|||||..|.::|.|||||:|||
Mouse     5 NWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALY 69

  Fly    71 SGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTD 135
            |||.||:||||:|||||.|||.:||:||.||    .||  |.:..|::|...:|.||||||||||
Mouse    70 SGIAPAMLRQASYGTIKIGTYQSLKRLAVER----PED--ETLLVNVVCGILSGVISSAIANPTD 128

  Fly   136 VLKVRMQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK--LQLM 198
            |||:|||........|::..|..||:.||.||||:||..|||||.::..|||||||..|  |.|.
Mouse   129 VLKIRMQAQNSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILS 193

  Fly   199 NAFGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263
            ...||.|..||:|||...|..|:||.|:||:|||:||||.:   .:|....      |.|:|||.
Mouse   194 GLMGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRAL---RDGRCAG------YKGTLDCL 249

  Fly   264 VQTIRNEGL 272
            :|...:.||
Mouse   250 LQVSVSAGL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 65/89 (73%)
Mito_carr <132..199 CDD:278578 37/68 (54%)
Mito_carr 204..303 CDD:278578 29/69 (42%)
Slc25a30XP_006519518.1 Mito_carr 6..96 CDD:365909 65/89 (73%)
Mito_carr 105..191 CDD:365909 44/85 (52%)
Mito_carr 199..>259 CDD:365909 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 140 1.000 Domainoid score I4737
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57046
Inparanoid 1 1.050 335 1.000 Inparanoid score I2388
Isobase 1 0.950 - 0 Normalized mean entropy S1382
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D1126848at2759
OrthoFinder 1 1.000 - - FOG0005838
OrthoInspector 1 1.000 - - otm44165
orthoMCL 1 0.900 - - OOG6_103926
Panther 1 1.100 - - LDO PTHR45618
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 1 1.000 - - X4231
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.