DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a11

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_071793.2 Gene:Slc25a11 / 64201 RGDID:708476 Length:314 Species:Rattus norvegicus


Alignment Length:302 Identity:100/302 - (33%)
Similarity:152/302 - (50%) Gaps:30/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74
            |::||:|.:.|.....|:|..|.|:|:.|    :......|:....|...|.:.||||.:|:|:.
  Rat    25 FLFGGLAGMGATVFVQPLDLVKNRMQLSG----EGAKTREYKTSFHALTSILKAEGLRGIYTGLS 85

  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVW-SNILCAAAAGAISSAIANPTDVLK 138
            ..:||||||.|.:.|.|..|    .||  |...||:...: ...|....|||..:.:..|.:|..
  Rat    86 AGLLRQATYTTTRLGIYTVL----FER
--LTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVAL 144

  Fly   139 VRMQVHGK---GQHKGLLGCFG---EIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQL 197
            :||...|:   .|.:|....|.   .|.:.|||..||||..||..||||:.:.:|..|...|..|
  Rat   145 IRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFL 209

  Fly   198 MNA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSL 260
            :::  |.|::..||.:|.|:.|.:..||.|:|:::||:.|.|.:.          ..|: |...|
  Rat   210 LDSG
YFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMID----------GKPE-YKNGL 263

  Fly   261 DCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKK 302
            |..::.:|.||..:|:|||.|.:.|:||..::.||..||:.|
  Rat   264 DVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/86 (35%)
Mito_carr <132..199 CDD:278578 26/72 (36%)
Mito_carr 204..303 CDD:278578 33/99 (33%)
Slc25a11NP_071793.2 Solcar 1 23..108 30/90 (33%)
Mito_carr 24..102 CDD:395101 28/80 (35%)
Mito_carr 116..213 CDD:395101 30/96 (31%)
Solcar 2 117..208 29/90 (32%)
Mito_carr 215..313 CDD:395101 35/102 (34%)
Solcar 3 217..306 34/100 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.