DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and slc25a10

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001017018.1 Gene:slc25a10 / 549772 XenbaseID:XB-GENE-955175 Length:286 Species:Xenopus tropicalis


Alignment Length:308 Identity:89/308 - (28%)
Similarity:142/308 - (46%) Gaps:42/308 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKDWRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRA 68
            |..|   .:||:||..|...|.|:|..|..||.| |::     ::|..||.   :.:.|.:|..|
 Frog     6 VSRW---YFGGLASCGAACCTHPLDLIKVHLQTQ-QEV-----KMRMTGMA---ISVIRNDGFLA 58

  Fly    69 LYSGIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANP 133
            ||:|:..::.||.||...:|..|.|    |.:| |:.:.......:..:|..|..|.....|..|
 Frog    59 LYNGLSASLFRQITYSLTRFAIYET----ARDR-LMQDNKAPLPFYQKVLLGAVGGFTGGFIGTP 118

  Fly   134 TDVLKVRMQ------VHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDF 192
            .|::.||||      .|.:..:...|.....:.:.||.|.|:.|....:.|..::...:|..||.
 Frog   119 ADMVNVRMQNDVKLPAHLRRNYAHALDGMFRVIREEGFRKLFSGATMASSRGALVTVGQLACYDQ 183

  Fly   193 CKLQLMNA--FGDHVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKL 255
            .|..::|.  ..|::..||::|.||...:.....|:||::|||||.:..                
 Frog   184 AKQLVLNTGFLSDNIFTHFLASSIAGGCATFLCQPLDVLKTRLMNAKGE---------------- 232

  Fly   256 YSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            |.|.:.|.::|.: .|..|.|||.:|..:|:.|..::.|:..|||:||
 Frog   233 YRGVVHCTLETAK-LGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 30/89 (34%)
Mito_carr <132..199 CDD:278578 18/72 (25%)
Mito_carr 204..303 CDD:278578 29/98 (30%)
slc25a10NP_001017018.1 Mito_carr 12..89 CDD:365909 31/90 (34%)
Mito_carr 96..190 CDD:365909 22/93 (24%)
Mito_carr 197..281 CDD:365909 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.