DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and Slc25a35

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001102503.1 Gene:Slc25a35 / 497933 RGDID:1598229 Length:300 Species:Rattus norvegicus


Alignment Length:305 Identity:91/305 - (29%)
Similarity:142/305 - (46%) Gaps:24/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74
            |:..|||:..|...|.|::..|||:|:||:.......|..||.:..||..|.:.:||.||..|:.
  Rat     3 FLMSGVAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFFTIGKVDGLAALQKGLG 67

  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139
            ||:|.|.....|:.|||    .||...|.|..::|:.....:....|.||.:.:.:.:|..::|.
  Rat    68 PALLYQFLMNGIRLGTY
----GLAESGGYLRTKEGTHSPVRSAAAGALAGVMGAYLGSPIYMVKT 128

  Fly   140 RMQVHGKGQ--------HKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK-- 194
            .:|.....:        |:|:.....||.:..|:.|||||......|.|:.:|.:|..:...|  
  Rat   129 HLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGAVGGLPRVVIGSSTQLCTFSSTKDL 193

  Fly   195 LQLMNAFGDHVGN-HFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSG 258
            |.....|...... ...::.::.:...:|.||.||..|||.|| |......|:        :|.|
  Rat   194 LS
QWEIFPPQSWKVALAAAMVSGVAVVLAMTPFDVASTRLYNQ-PTDTRGKGL--------MYRG 249

  Fly   259 SLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
            .||..:||.|.|||..:|||...::.|:||..|:....::||:.:
  Rat   250 ILDALLQTARTEGLFGMYKGIGASYFRLGPHTILSLFFWDQLRSF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 32/86 (37%)
Mito_carr <132..199 CDD:278578 19/76 (25%)
Mito_carr 204..303 CDD:278578 31/99 (31%)
Slc25a35NP_001102503.1 Mito_carr 2..84 CDD:395101 30/80 (38%)
Mito_carr 98..195 CDD:395101 22/96 (23%)
Mito_carr 209..298 CDD:395101 31/95 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.