DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and rangrf

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_002941865.3 Gene:rangrf / 496602 XenbaseID:XB-GENE-5760490 Length:238 Species:Xenopus tropicalis


Alignment Length:46 Identity:9/46 - (19%)
Similarity:22/46 - (47%) Gaps:7/46 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWPAVL 78
            |.:::|:..:.       |..:.|...::::.....|::|.:.|||
 Frog    30 RAEVEGKHAED-------RNASSADSPMAQDSQPHPLFAGAFSAVL 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 9/46 (20%)
Mito_carr <132..199 CDD:278578
Mito_carr 204..303 CDD:278578
rangrfXP_002941865.3 Mog1 58..238 CDD:238137 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.