DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and CG7943

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:324 Identity:77/324 - (23%)
Similarity:120/324 - (37%) Gaps:86/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WRPFVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYS 71
            |..|..|..|:......|:||.....|..:.|..|..:|:|||:             |||..||.
  Fly    54 WEEFACGCGAAFVNIAVTYPIYKMIFRQMLHGVPITSAFAQLRH-------------EGLGFLYR 105

  Fly    72 GIWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDV 136
            |:.|.:.::....:|.||.:...::...| ...:|:.|::     :|.|..||:..| |..|.:.
  Fly   106 GMLPPLAQKTISLSIMFGVFDGTRRYLVE-DYRLNDYGAK-----VLAAVVAGSAES-ILLPFER 163

  Fly   137 LKVRMQVHGKGQH-KGLLGCFGEIYKYEGVRGLWRGVGPTAQR-----AVVI-----ASVELPVY 190
            ::..:......|| ......|..:..:.|.|.|:||:.|...|     |:..     |||.||. 
  Fly   164 VQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLSNALFFVLREEASVRLPK- 227

  Fly   191 DFCKLQLMNAFGDHVGNHFISSFIAS--LGSAIAST--PIDVIRTRL---MNQRPVSITMNGVVT 248
                       ...|....:..|||.  :|::|::.  |::||:..|   |.||.          
  Fly   228 -----------RKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRS---------- 271

  Fly   249 AAATPKLYSGSLDCA--VQTIRNEGLPALYKG--------FIPTWVRMGPWNIIFFITYEQLKK 302
                    .||....  :...|:..:...|:|        ||       .|.|: ...||.|||
  Fly   272 --------EGSWQACKRIYVERDRRIGNFYRGCPFNTGRSFI-------SWGIM-NTAYENLKK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 24/89 (27%)
Mito_carr <132..199 CDD:278578 17/77 (22%)
Mito_carr 204..303 CDD:278578 27/116 (23%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 25/95 (26%)
Mito_carr 141..229 CDD:278578 24/105 (23%)
Mito_carr 235..322 CDD:278578 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.