DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and mfrn

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:297 Identity:78/297 - (26%)
Similarity:127/297 - (42%) Gaps:42/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GGVASITAEFGTFPIDTTKTRLQIQG--QKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIWP 75
            |.:|.:......:|:|:.|||:|...  .|.....|.||        ..|:||..||.: .|...
  Fly    21 GAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLR--------TMITREGLLRPI-RGASA 76

  Fly    76 AVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKVR 140
            .||......::.|..|...|:|.       .:..|.|..:.::..|.|..|..||::||||:|.|
  Fly    77 VVLGAGPAHSLYFAAYEMTKELT-------AKFTSVRNLNYVISGAVATLIHDAISSPTDVIKQR 134

  Fly   141 MQVHGKGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFC--KLQLMNAFGD 203
            ||:: ...:..::.|..:|||.||.:..:|..|......:...::....|:|.  |:.|...:..
  Fly   135 MQMY-NSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQNKMNLERKYNP 198

  Fly   204 HVGNHFISSFIASLGSAIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLY--SGSLDCAVQT 266
            .|  |..:...|...:|..:||:|||:| |:|.:...:| .|::.|:.  |:|  :|.|      
  Fly   199 PV--HMAAGAAAGACAAAVTTPLDVIKT-LLNTQETGLT-RGMIEASR--KIYHMAGPL------ 251

  Fly   267 IRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQLKKY 303
                   ..::|.....:...|...|.:.|||..|.|
  Fly   252 -------GFFRGTTARVLYSMPATAICWSTYEFFKFY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 23/85 (27%)
Mito_carr <132..199 CDD:278578 20/68 (29%)
Mito_carr 204..303 CDD:278578 26/100 (26%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 23/85 (27%)
PTZ00168 17..280 CDD:185494 76/294 (26%)
Mito_carr 107..190 CDD:278578 23/83 (28%)
Mito_carr <215..282 CDD:278578 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.