DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bmcp and DPCoAC

DIOPT Version :9

Sequence 1:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:302 Identity:85/302 - (28%)
Similarity:134/302 - (44%) Gaps:34/302 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFS---QLRYRGMTDAFVKISREEGLRALYSG 72
            :.|..|...|:....|:|.||...||:.   |..||   .|||...|.|      .||:.||:.|
  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIRN---DVPFSFRASLRYLQNTYA------NEGVLALWRG 132

  Fly    73 IWPAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVL 137
            ....:.|...|..|:|..:...:::     |.:::||:.......|..:.||..|.::..|.|:.
  Fly   133 NSATMARIVPYAAIQFTAHEQWRRI-----LH
VDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLA 192

  Fly   138 KVRMQVHGK-GQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQLMNAF 201
            :.||.|..: ..::.|...|.:|:..||.|.|:||...|....:..|......|:..|.:.....
  Fly   193 RARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVV 257

  Fly   202 GDHVGNHFIS-SFIASLGSA--IASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLYSGSLDCA 263
            |::..|..:| :|.|:.|:|  .||.|:|::|.|:...|        |.||..  ..|...|:..
  Fly   258 GNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMR--------VNTAGG--DRYPTILETL 312

  Fly   264 VQTIRNEGLP-ALYKGFIPTWVRMGPWNI-IFFITYEQLKKY 303
            |:..|.||:. ..|||....|:: ||..: |.|.||:.:|.:
  Fly   313 VKIYREEGVKNGFYKGLSMNWIK-GPIAVGISFSTYDLIKAW 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 26/88 (30%)
Mito_carr <132..199 CDD:278578 18/67 (27%)
Mito_carr 204..303 CDD:278578 33/103 (32%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 26/95 (27%)
Mito_carr 169..251 CDD:278578 21/81 (26%)
Mito_carr 279..356 CDD:278578 27/86 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442103
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.